Burun estetiği (Rinoplasti) ameliyatları hakkında hizmet bilgisi ve fiyat alabileceğiniz İstanbul Onep Estetik ve Plastik Cerrahi Kliniği.

2.47 Rating by CuteStat

burunestetigi.com is 1 decade 5 years old. It is a domain having com extension. It has a global traffic rank of #18821103 in the world. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. Furthermore the website is monetizing from Google Adsense. As no active threats were reported recently by users, burunestetigi.com is SAFE to browse.

PageSpeed Score
48
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 26
Daily Pageviews: 52

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 18,821,103
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

77.92.140.32

Hosted Country:

Türkiye TR

Location Latitude:

41.0214

Location Longitude:

28.9948

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: 13 H4 Headings: 4
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: 2 Total Images: 16
Google Adsense: pub-4187249499649652 Google Analytics: UA-52547582-3

Websites Hosted on Same IP (i.e. 77.92.140.32)

Kötü Sözlük'tü.

- kotusozluk.com
4,085,720 $ 240.00

Tam Haber | Güncel Haberler ve Son Dakika Haberleri

- tamhaber.com.tr

Tüm sosyal medya, gazete ve internet haberleri, köşe yazarları, son dakika haberler ve halk için habercilik anlayışı ile Türkiye'nin gerçek haber sitesi.

7,102,027 $ 240.00

Index of /

- chicopeekedikopekmamalari.com
Not Applicable $ 8.95

Maya Cupcake | Harika Cupcake Çeşitleri

- mayacupcake.com

Doğumgünü, düğün ve özel gün cupcake çeşitlerimiz ile karşınızdayız.

19,998,643 $ 8.95

Index of /

- tuvalettikanikligiacmafiyatlari.net
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Thu, 08 Jun 2017 19:01:55 GMT
Server: Apache/2.4.16 (Unix) OpenSSL/1.0.1e-fips mod_bwlimited/1.4
X-Powered-By: PHP/5.4.45
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
X-Pingback: http://www.burunestetigi.com/xmlrpc.php
Link: <http://www.burunestetigi.com/>; rel=shortlink
Content-Length: 50409
Connection: close
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registration Date: Oct 24, 2008, 12:00 AM 1 decade 5 years 7 months ago
Last Modified: May 22, 2017, 12:00 AM 7 years 1 month 18 hours ago
Expiration Date: Oct 24, 2017, 12:00 AM 6 years 7 months 3 weeks ago
Domain Status:
clientTransferProhibited

DNS Record Analysis

Host Type TTL Extra
burunestetigi.com A 14388 IP: 77.92.140.32
burunestetigi.com NS 86399 Target: ns2.kotuhost.com
burunestetigi.com NS 86399 Target: ns1.kotuhost.com
burunestetigi.com SOA 86399 MNAME: ns1.kotuhost.com
RNAME: destek.labina.com.tr
Serial: 2015061800
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 86400
burunestetigi.com MX 14399 Target: burunestetigi.com
burunestetigi.com TXT 14399 TXT: v=spf1 +a +mx +ip4:77.92.140.32 ~all

Similarly Ranked Websites

Demo Biru

- demo-biru.online

Demo Biru

18,821,106 $ 8.95

viralshare

- viralshare.mobi
18,821,128 $ 8.95

Home Design - House Design - Interior Design Ideas - Interior Designs

- beachhouse24h.com

BeachHouse24H.Com - Inspirational Interior Design Ideas for Living Room Design, Bedroom Design, Kitchen Design and the entire home. Home Designing Blog Magazine covering.

18,821,145 $ 8.95

Index of /

- nicolemariewilhelm.com
18,821,155 $ 8.95

403 Forbidden

- drcuevasnp.com
18,821,174 $ 8.95